PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10015303m
Common NameEUTSA_v10015303mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family MIKC_MADS
Protein Properties Length: 219aa    MW: 25184.2 Da    PI: 9.6048
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10015303mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.81.4e-28959151
                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
           SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                     k+ien + rqvtfskRr g++KKA+ELSvLCda+va i+fs++g+lye+ss
  Thhalv10015303m  9 KKIENVTSRQVTFSKRRSGLFKKAHELSVLCDAQVAAIVFSQSGRLYEFSS 59
                     68***********************************************96 PP

2K-box63.48.3e-22881711497
            K-box  14 aeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                       ++l++e++ + k+i+ L+  qR+l+G++L+s+s+ eLq++ +q+eksl+ +RskK +l+ +q+++l++ke++l +e ++Lr++
  Thhalv10015303m  88 LQKLKKEMDIMMKKIDLLELHQRKLMGQGLGSCSVAELQEIDTQIEKSLRIVRSKKADLFADQLRQLKEKERKLLDERRRLREE 171
                      6999*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.9E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.581161IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.11E-32376IPR002100Transcription factor, MADS-box
CDDcd002651.04E-42375No hitNo description
PRINTSPR004043.6E-29323IPR002100Transcription factor, MADS-box
PfamPF003192.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004043.6E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.69588179IPR002487Transcription factor, K-box
PfamPF014864.4E-2189171IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MVRGKIEIKK IENVTSRQVT FSKRRSGLFK KAHELSVLCD AQVAAIVFSQ SGRLYEFSSS  60
EMEKTIERYG KFTNGYFVSG RFQVELYLQK LKKEMDIMMK KIDLLELHQR KLMGQGLGSC  120
SVAELQEIDT QIEKSLRIVR SKKADLFADQ LRQLKEKERK LLDERRRLRE EEIKERLMRP  180
MQPITLHSEK GEAEDGCGTN HSAEVETELF IGLPVAGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D1e-18372271Myocyte-specific enhancer factor 2A
3mu6_C1e-18372271Myocyte-specific enhancer factor 2A
3mu6_B1e-18372271Myocyte-specific enhancer factor 2A
3mu6_A1e-18372271Myocyte-specific enhancer factor 2A
1tqe_S1e-18173173Myocyte-specific enhancer factor 2B
1tqe_R1e-18173173Myocyte-specific enhancer factor 2B
1tqe_Q1e-18173173Myocyte-specific enhancer factor 2B
1tqe_P1e-18173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006401901.11e-157hypothetical protein EUTSA_v10015303mg
SwissprotQ9LT931e-109AGL71_ARATH; MADS-box protein AGL71
TrEMBLV4LHX61e-157V4LHX6_EUTSA; Uncharacterized protein
STRINGAT5G51870.31e-114(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51870.33e-92AGAMOUS-like 71